PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P20070_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 574aa    MW: 61516.8 Da    PI: 6.0336
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P20070_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS309.95.7e-952314982285
                    GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                              +lLl+cAeav++++le+a++lL ++sel++p g++ qR+aayf eA++arl++s+ +ly+ lp+ + +     + ++a+++f+ +s
  GSMUA_Achr11P20070_001 231 LTLLLHCAEAVAADNLEEANRLLLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGLYAPLPTVPHR----HRLASAFQVFNGIS 313
                             579************************************************************999997....788999******** PP

                    GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvp 175
                             P++kfsh+taNqaI ea+e+e+rvHiiDfdi+qGlQWp L++ LasRp+gpp++R+Tg+g     s e+le+tg+rL++fAe+lg+p
  GSMUA_Achr11P20070_001 314 PFVKFSHFTANQAIQEAFEREDRVHIIDFDIMQGLQWPGLFHILASRPGGPPRVRLTGLGY----SMEALEATGKRLSDFAETLGLP 396
                             *************************************************************....********************** PP

                    GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                             fef + +a+++ +l++e+L v+++EalaV++    h+l+d ++s ++    +L+l+++l Pkvv++veq+++  ++sFl+rf+ea++
  GSMUA_Achr11P20070_001 397 FEFIP-IAEKVGNLDPERLGVSRREALAVHWLQ--HSLYDVTGSDTN----TLWLLQRLAPKVVTMVEQDLSQ-AGSFLARFVEAIH 475
                             *****.7*************************9..999999999999....********************98.899********** PP

                    GRAS 263 yysalfdsleaklpreseerikv 285
                             yysalfdsl a+++++s+er+ v
  GSMUA_Achr11P20070_001 476 YYSALFDSLGASYSEDSQERHIV 498
                             ********************986 PP

2GRAS59.95.4e-19499562311374
                    GRAS 311 tlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                             ++++Wre+l+++GF+ v+l  +aa+qa lll +++sdgy++ ee+g+l lgWkd  L+++SaWr
  GSMUA_Achr11P20070_001 499 KFSNWREKLGQSGFRGVSLAGNAAAQATLLLGMFPSDGYTLVEENGTLKLGWKDLCLLTASAWR 562
                             6899***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.963204574IPR005202Transcription factor GRAS
PfamPF035142.0E-92231498IPR005202Transcription factor GRAS
PfamPF035141.9E-16499562IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MVKKRLASEL DLQSGPSSYS AARLPRRGVS TGSSATPAST PPVPLPSLPA PPLPALPSPA  60
VCGFSGLPPF PPEFDRIVLP ASSAEGLQLV SSSAGGVGGG GSDDDGAGTA WVDGIIRDII  120
SSSAGGEVSI PQIVNSVREI VHPCNPGLAA LLELRLRSLI SDPMPPPLPE SAQQRPQPPL  180
QPQTHPQRSS NSVSSEEATA ATSAAAAAAA AKEKRDELQQ RKRDEEGLHL LTLLLHCAEA  240
VAADNLEEAN RLLLEISELS TPFGTSAQRV AAYFSEAMSA RLVSSCLGLY APLPTVPHRH  300
RLASAFQVFN GISPFVKFSH FTANQAIQEA FEREDRVHII DFDIMQGLQW PGLFHILASR  360
PGGPPRVRLT GLGYSMEALE ATGKRLSDFA ETLGLPFEFI PIAEKVGNLD PERLGVSRRE  420
ALAVHWLQHS LYDVTGSDTN TLWLLQRLAP KVVTMVEQDL SQAGSFLARF VEAIHYYSAL  480
FDSLGASYSE DSQERHIVKF SNWREKLGQS GFRGVSLAGN AAAQATLLLG MFPSDGYTLV  540
EENGTLKLGW KDLCLLTASA WRPISHSRPP PPPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-482305624375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384356.10.0PREDICTED: protein SCARECROW 2-like
SwissprotQ9M3840.0SCR_ARATH; Protein SCARECROW
TrEMBLM0RTT70.0M0RTT7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P20070_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein